SCOPe 2.08: Domain d5ihzl2: 5ihz L:128-231

Lineage for d5ihzl2 (5ihz L:128-231)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
Domain d5ihzl2: 5ihz L:128-231 [331458]
Other proteins in same PDB: d5ihza_, d5ihzb1, d5ihzc_, d5ihzd1, d5ihze_, d5ihzf1, d5ihzh_, d5ihzl1
automated match to d5azel2

Details for d5ihzl2

PDB Entry: 5ihz (more details), 1.64 Å

PDB Description: crystal structure of anti-gliadin 1002-1e01 fab fragment

PDB Compounds: (L:) 1E01 Fab fragment light chain

SCOPe Domain Sequences for d5ihzl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ihzl2 b.1.1.2 (L:128-231) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpsk
qsnnkyaassylsltpeqwkshrsyscqvthegstvektvapte

SCOPe Domain Coordinates for d5ihzl2:

Click to download the PDB-style file with coordinates for d5ihzl2.
(The format of our PDB-style files is described here.)

Timeline for d5ihzl2: