SCOPe 2.08: Domain d5ihzl1: 5ihz L:1-127

Lineage for d5ihzl1 (5ihz L:1-127)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5ihzl1: 5ihz L:1-127 [331457]
   Other proteins in same PDB: d5ihza_, d5ihzb2, d5ihzc_, d5ihzd2, d5ihze_, d5ihzf2, d5ihzh_, d5ihzl2
   automated match to d4m1dl1

Details for d5ihzl1

PDB Entry: 5ihz, 1.64 Å

PDB Description: crystal structure of anti-gliadin 1002-1e01 fab fragment

PDB Compounds: (L:) 1E01 Fab fragment light chain

SCOPe Domain Sequences for d5ihzl1:

Sequence; same for both SEQRES and ATOM records:

>d5ihzl1 b.1.1.0 (L:1-127) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlvltqspsasaslgasvrltctlssghssyviawhqqqsekgprylmkvnsdgshskgd
gipdrfsgsssgaeryltisslqsedeadyycqtwgagilvfgggtkltvl

Timeline for d5ihzl1:

• d5ihzl1 first appeared in SCOPe 2.06
  
• d5ihzl1 appears in SCOPe 2.07