Lineage for d5us1g_ (5us1 G:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969350Species Providencia stuartii [TaxId:588] [331391] (6 PDB entries)
  8. 2969366Domain d5us1g_: 5us1 G: [331441]
    Other proteins in same PDB: d5us1a2, d5us1c2, d5us1e2, d5us1j2, d5us1k2
    automated match to d1m44a_
    complexed with 8mm, aco, coa, gol, tar

Details for d5us1g_

PDB Entry: 5us1 (more details), 2.48 Å

PDB Description: crystal structure of aminoglycoside acetyltransferase aac(2')-ia in complex with n2'-acetylgentamicin c1a and coenzyme a
PDB Compounds: (G:) Aminoglycoside 2'-N-acetyltransferase

SCOPe Domain Sequences for d5us1g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5us1g_ d.108.1.0 (G:) automated matches {Providencia stuartii [TaxId: 588]}
gieyrslhtsqltlsekealydlliegfegdfshddfahtlggmhvmafdqqklvghvai
iqrhmaldntpisvgyveamvveqsyrrqgigrqlmlqtnkiiascyqlgllsasddgqk
lyhsvgwqiwkgklfelkqgsyirsieeeggvmgwkadgevdftaslycdfrggdqw

SCOPe Domain Coordinates for d5us1g_:

Click to download the PDB-style file with coordinates for d5us1g_.
(The format of our PDB-style files is described here.)

Timeline for d5us1g_: