Lineage for d1a3xa3 (1a3x A:367-500)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120383Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 2120384Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) (S)
  5. 2120385Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
    automatically mapped to Pfam PF02887
  6. 2120386Protein Pyruvate kinase, C-terminal domain [52937] (6 species)
  7. 2120387Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52941] (2 PDB entries)
  8. 2120390Domain d1a3xa3: 1a3x A:367-500 [33144]
    Other proteins in same PDB: d1a3xa1, d1a3xa2, d1a3xb1, d1a3xb2
    complexed with k, mn, pga

Details for d1a3xa3

PDB Entry: 1a3x (more details), 3 Å

PDB Description: pyruvate kinase from saccharomyces cerevisiae complexed with pg, mn2+ and k+
PDB Compounds: (A:) pyruvate kinase

SCOPe Domain Sequences for d1a3xa3:

Sequence, based on SEQRES records: (download)

>d1a3xa3 c.49.1.1 (A:367-500) Pyruvate kinase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dmrnctpkptsttetvaasavaavfeqkakaiivlstsgttprlvskyrpncpiilvtrc
praarfshlyrgvfpfvfekepvsdwtddvearinfgiekakefgilkkgdtyvsiqgfk
agaghsntlqvstv

Sequence, based on observed residues (ATOM records): (download)

>d1a3xa3 c.49.1.1 (A:367-500) Pyruvate kinase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dmrnctpkptsttetvaasavaavfeqkakaiivlstsgttprlvskyrpncpiilvtrc
praarfshlyrgvfpfvfeketddvearinfgiekakefgilkkgdtyvsiqgntlqvst
v

SCOPe Domain Coordinates for d1a3xa3:

Click to download the PDB-style file with coordinates for d1a3xa3.
(The format of our PDB-style files is described here.)

Timeline for d1a3xa3: