Lineage for d1a3wb3 (1a3w B:367-500)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1371047Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 1371048Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) (S)
  5. 1371049Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
    automatically mapped to Pfam PF02887
  6. 1371050Protein Pyruvate kinase, C-terminal domain [52937] (6 species)
  7. 1371051Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52941] (2 PDB entries)
  8. 1371053Domain d1a3wb3: 1a3w B:367-500 [33143]
    Other proteins in same PDB: d1a3wa1, d1a3wa2, d1a3wb1, d1a3wb2
    complexed with fbp, k, mn, pga

Details for d1a3wb3

PDB Entry: 1a3w (more details), 3 Å

PDB Description: pyruvate kinase from saccharomyces cerevisiae complexed with fbp, pg, mn2+ and k+
PDB Compounds: (B:) pyruvate kinase

SCOPe Domain Sequences for d1a3wb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a3wb3 c.49.1.1 (B:367-500) Pyruvate kinase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dmrnctpkptsttetvaasavaavfeqkakaiivlstsgttprlvskyrpncpiilvtrc
praarfshlyrgvfpfvfekepvsdwtddvearinfgiekakefgilkkgdtyvsiqgfk
agaghsntlqvstv

SCOPe Domain Coordinates for d1a3wb3:

Click to download the PDB-style file with coordinates for d1a3wb3.
(The format of our PDB-style files is described here.)

Timeline for d1a3wb3: