Lineage for d1a3wa3 (1a3w A:367-500)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24606Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
  4. 24607Superfamily c.49.1: Pyruvate kinase, C-terminal domain [52935] (1 family) (S)
  5. 24608Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
  6. 24609Protein Pyruvate kinase, C-terminal domain [52937] (5 species)
  7. 24610Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52941] (2 PDB entries)
  8. 24611Domain d1a3wa3: 1a3w A:367-500 [33142]
    Other proteins in same PDB: d1a3wa1, d1a3wa2, d1a3wb1, d1a3wb2

Details for d1a3wa3

PDB Entry: 1a3w (more details), 3 Å

PDB Description: pyruvate kinase from saccharomyces cerevisiae complexed with fbp, pg, mn2+ and k+
PDB Compounds: (A:)

SCOP Domain Sequences for d1a3wa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a3wa3 c.49.1.1 (A:367-500) Pyruvate kinase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
dmrnctpkptsttetvaasavaavfeqkakaiivlstsgttprlvskyrpncpiilvtrc
praarfshlyrgvfpfvfekepvsdwtddvearinfgiekakefgilkkgdtyvsiqgfk
agaghsntlqvstv

SCOP Domain Coordinates for d1a3wa3:

Click to download the PDB-style file with coordinates for d1a3wa3.
(The format of our PDB-style files is described here.)

Timeline for d1a3wa3: