Lineage for d1pklh3 (1pkl H:358-498)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71332Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
  4. 71333Superfamily c.49.1: Pyruvate kinase, C-terminal domain [52935] (1 family) (S)
  5. 71334Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
  6. 71335Protein Pyruvate kinase, C-terminal domain [52937] (5 species)
  7. 71356Species Leishmania mexicana [TaxId:5665] [52940] (1 PDB entry)
  8. 71364Domain d1pklh3: 1pkl H:358-498 [33141]
    Other proteins in same PDB: d1pkla1, d1pkla2, d1pklb1, d1pklb2, d1pklc1, d1pklc2, d1pkld1, d1pkld2, d1pkle1, d1pkle2, d1pklf1, d1pklf2, d1pklg1, d1pklg2, d1pklh1, d1pklh2

Details for d1pklh3

PDB Entry: 1pkl (more details), 2.35 Å

PDB Description: the structure of leishmania pyruvate kinase

SCOP Domain Sequences for d1pklh3:

Sequence, based on SEQRES records: (download)

>d1pklh3 c.49.1.1 (H:358-498) Pyruvate kinase, C-terminal domain {Leishmania mexicana}
neyvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncp
ivcvttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycv
vihadhkvkgyanqtrillve

Sequence, based on observed residues (ATOM records): (download)

>d1pklh3 c.49.1.1 (H:358-498) Pyruvate kinase, C-terminal domain {Leishmania mexicana}
neyvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncp
ivcvttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycv
vihadanqtrillve

SCOP Domain Coordinates for d1pklh3:

Click to download the PDB-style file with coordinates for d1pklh3.
(The format of our PDB-style files is described here.)

Timeline for d1pklh3: