![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) ![]() |
![]() | Family d.104.1.0: automated matches [227172] (1 protein) not a true family |
![]() | Protein automated matches [226887] (24 species) not a true protein |
![]() | Species Enterococcus faecalis [TaxId:226185] [330979] (5 PDB entries) |
![]() | Domain d5ichb1: 5ich B:1-247 [331404] Other proteins in same PDB: d5icha2, d5icha3, d5ichb2, d5ichb3 automated match to d1vqza2 complexed with sh5 |
PDB Entry: 5ich (more details), 1.85 Å
SCOPe Domain Sequences for d5ichb1:
Sequence, based on SEQRES records: (download)
>d5ichb1 d.104.1.0 (B:1-247) automated matches {Enterococcus faecalis [TaxId: 226185]} mifvpnenndprvnlaietylltempldepillfyinepsiiigrnqntieeinkeyvde hgihvvrrlsgggavyhdhgnlnfsfimpddgnsfrdfakvtqpiiqalhdlgvegaelk grndlvindmkfsgnamyatngrmfahgtlmfdsdidevvntlkvrkdkieskgiksvrs rvtnikpflsedkqemtteefrqeillkifgvdsidqvktyeltdqdwaainkiseqyyr nwdwnyg
>d5ichb1 d.104.1.0 (B:1-247) automated matches {Enterococcus faecalis [TaxId: 226185]} mifvpnenndprvnlaietylltempldepillfyinepsiiigrnqntieeinkeyvde hgihvvrrlsgggavyhdhgnlnfsfimpddfakvtqpiiqalhdlgvegaelkgrndlv indmkfsgnamyatngrmfahgtlmfdsdidevvntlvtnikpflsedkqemtteefrqe illkifgvdsidqvktyeltdqdwaainkiseqyyrnwdwnyg
Timeline for d5ichb1: