SCOPe 2.07: Domain d5tz2l1: 5tz2 L:1-106

Lineage for d5tz2l1 (5tz2 L:1-106)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)

8. Domain d5tz2l1: 5tz2 L:1-106 [331378]
   Other proteins in same PDB: d5tz2l2
   automated match to d1dn0a1
   complexed with gol, nag

Details for d5tz2l1

PDB Entry: 5tz2, 2.3 Å

PDB Description: crystal structure of human cd47 ecd bound to fab of c47b222

PDB Compounds: (L:) C47B222 Fab Light Chain

SCOPe Domain Sequences for d5tz2l1:

Sequence; same for both SEQRES and ATOM records:

>d5tz2l1 b.1.1.1 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspatlslspgeratlscrasqsvnnrlawyqqkpgqaprllihwastraigipa
rfsgsgsgtdftltisslepedfavyycqqgaswpftfgqgtkvei

Timeline for d5tz2l1:

• d5tz2l1 first appeared in SCOPe 2.06
  
• d5tz2l1 appears in the current release, SCOPe 2.08