Lineage for d5lgjb3 (5lgj B:439-546)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757013Domain d5lgjb3: 5lgj B:439-546 [331368]
    automated match to d1o0va3
    complexed with gol, pg4, so4; mutant

Details for d5lgjb3

PDB Entry: 5lgj (more details), 2.6 Å

PDB Description: the crystal structure of ige fc mutant - p333c
PDB Compounds: (B:) ig epsilon chain c region

SCOPe Domain Sequences for d5lgjb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lgjb3 b.1.1.0 (B:439-546) automated matches {Human (Homo sapiens) [TaxId: 9606]}
praapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprkt
kgsgffvfsrlevtraeweqkdeficravheaaspsqtvqravsvnpg

SCOPe Domain Coordinates for d5lgjb3:

Click to download the PDB-style file with coordinates for d5lgjb3.
(The format of our PDB-style files is described here.)

Timeline for d5lgjb3: