SCOPe 2.07: Domain d5pnha_: 5pnh A:

Lineage for d5pnha_ (5pnh A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.14: Histone demethylase core [254153] (4 proteins)
   Jumonji domain; Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801

6. Protein automated matches [254635] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255633] (266 PDB entries)

8. Domain d5pnha_: 5pnh A: [331356]
   automated match to d3dxua_
   complexed with edo, mg, ni, oga, so4, zn

Details for d5pnha_

PDB Entry: 5pnh, 1.14 Å

PDB Description: pandda analysis group deposition -- crystal structure of jmjd2d after initial refinement with no ligand modelled (structure 211)

PDB Compounds: (A:) Lysine-specific demethylase 4D

SCOPe Domain Sequences for d5pnha_:

Sequence; same for both SEQRES and ATOM records:

>d5pnha_ b.82.2.14 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqnpncnimifhptkeefndfdkyiaymesqgahraglakiippkewkaretydniseil
iatplqqvasgragvftqyhkkkkamtvgeyrhlanskkyqtpphqnfedlerkywknri
ynspiygadisgslfdentkqwnlghlgtiqdllekecgvviegvntpylyfgmwkttfa
whtedmdlysinylhlgepktwyvvppehgqrlerlarelfpgssrgcgaflrhkvalis
ptvlkengipfnritqeagefmvtfpygyhagfnhgfncaeainfatprwidygkmasqc
scgearvtfsmdafvrilqperydlwkrgqd

Timeline for d5pnha_:

• d5pnha_ first appeared in SCOPe 2.06