Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [226687] (4 PDB entries) |
Domain d5th9m2: 5th9 M:107-214 [331348] Other proteins in same PDB: d5th9l1, d5th9m1, d5th9n_ automated match to d1dn0a2 complexed with ca, nco, zn |
PDB Entry: 5th9 (more details), 3 Å
SCOPe Domain Sequences for d5th9m2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5th9m2 b.1.1.2 (M:107-214) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
Timeline for d5th9m2: