Lineage for d5ihzd1 (5ihz D:1-127)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2754772Domain d5ihzd1: 5ihz D:1-127 [331340]
    Other proteins in same PDB: d5ihza_, d5ihzb2, d5ihzc_, d5ihzd2, d5ihze_, d5ihzf2, d5ihzh_, d5ihzl2
    automated match to d4m1dl1

Details for d5ihzd1

PDB Entry: 5ihz (more details), 1.64 Å

PDB Description: crystal structure of anti-gliadin 1002-1e01 fab fragment
PDB Compounds: (D:) 1E01 Fab fragment light chain

SCOPe Domain Sequences for d5ihzd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ihzd1 b.1.1.0 (D:1-127) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlvltqspsasaslgasvrltctlssghssyviawhqqqsekgprylmkvnsdgshskgd
gipdrfsgsssgaeryltisslqsedeadyycqtwgagilvfgggtkltvl

SCOPe Domain Coordinates for d5ihzd1:

Click to download the PDB-style file with coordinates for d5ihzd1.
(The format of our PDB-style files is described here.)

Timeline for d5ihzd1: