Lineage for d1aqfd3 (1aqf D:396-530)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71332Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
  4. 71333Superfamily c.49.1: Pyruvate kinase, C-terminal domain [52935] (1 family) (S)
  5. 71334Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
  6. 71335Protein Pyruvate kinase, C-terminal domain [52937] (5 species)
  7. 71365Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [52939] (4 PDB entries)
  8. 71386Domain d1aqfd3: 1aqf D:396-530 [33129]
    Other proteins in same PDB: d1aqfa1, d1aqfa2, d1aqfb1, d1aqfb2, d1aqfc1, d1aqfc2, d1aqfd1, d1aqfd2, d1aqfe1, d1aqfe2, d1aqff1, d1aqff2, d1aqfg1, d1aqfg2, d1aqfh1, d1aqfh2

Details for d1aqfd3

PDB Entry: 1aqf (more details), 2.7 Å

PDB Description: pyruvate kinase from rabbit muscle with mg, k, and l-phospholactate

SCOP Domain Sequences for d1aqfd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqfd3 c.49.1.1 (D:396-530) Pyruvate kinase, C-terminal domain {Rabbit (Oryctolagus cuniculus)}
elarssshstdlmeamamgsveasykclaaalivltesgrsahqvaryrprapiiavtrn
hqtarqahlyrgifpvvckdpvqeawaedvdlrvnlamnvgkargffkkgdvvivltgwr
pgsgftntmrvvpvp

SCOP Domain Coordinates for d1aqfd3:

Click to download the PDB-style file with coordinates for d1aqfd3.
(The format of our PDB-style files is described here.)

Timeline for d1aqfd3: