Lineage for d5ph9a_ (5ph9 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2815433Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2815818Family b.82.2.14: Jumonji domain / Histone demethylase core [254153] (7 proteins)
    Jumonji domain; Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801
    Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801; some members include C-terminal helical subdomain (Pfam PF17811)
  6. 2815997Protein JMJD2D core [254343] (1 species)
  7. 2815998Species Human (Homo sapiens) [TaxId:9606] [254776] (275 PDB entries)
  8. 2816180Domain d5ph9a_: 5ph9 A: [331236]
    automated match to d3dxua_
    complexed with edo, luz, ni, oga, so4, zn

Details for d5ph9a_

PDB Entry: 5ph9 (more details), 1.48 Å

PDB Description: pandda analysis group deposition -- crystal structure of jmjd2d in complex with n09701a
PDB Compounds: (A:) Lysine-specific demethylase 4D

SCOPe Domain Sequences for d5ph9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ph9a_ b.82.2.14 (A:) JMJD2D core {Human (Homo sapiens) [TaxId: 9606]}
aqnpncnimifhptkeefndfdkyiaymesqgahraglakiippkewkaretydniseil
iatplqqvasgragvftqyhkkkkamtvgeyrhlanskkyqtpphqnfedlerkywknri
ynspiygadisgslfdentkqwnlghlgtiqdllekecgvviegvntpylyfgmwkttfa
whtedmdlysinylhlgepktwyvvppehgqrlerlarelfpgssrgcgaflrhkvalis
ptvlkengipfnritqeagefmvtfpygyhagfnhgfncaeainfatprwidygkmasqc
scgearvtfsmdafvrilqperydlwkrgqd

SCOPe Domain Coordinates for d5ph9a_:

Click to download the PDB-style file with coordinates for d5ph9a_.
(The format of our PDB-style files is described here.)

Timeline for d5ph9a_: