Lineage for d1a5ug3 (1a5u G:4596-4730)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 700401Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 700402Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) (S)
  5. 700403Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
  6. 700404Protein Pyruvate kinase, C-terminal domain [52937] (6 species)
  7. 700451Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [52939] (7 PDB entries)
  8. 700474Domain d1a5ug3: 1a5u G:4596-4730 [33123]
    Other proteins in same PDB: d1a5ua1, d1a5ua2, d1a5ub1, d1a5ub2, d1a5uc1, d1a5uc2, d1a5ud1, d1a5ud2, d1a5ue1, d1a5ue2, d1a5uf1, d1a5uf2, d1a5ug1, d1a5ug2, d1a5uh1, d1a5uh2

Details for d1a5ug3

PDB Entry: 1a5u (more details), 2.35 Å

PDB Description: pyruvate kinase complex with bis mg-atp-na-oxalate
PDB Compounds: (G:) pyruvate kinase

SCOP Domain Sequences for d1a5ug3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a5ug3 c.49.1.1 (G:4596-4730) Pyruvate kinase, C-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
elarssshstdlmeamamgsveasykclaaalivltesgrsahqvaryrprapiiavtrn
hqtarqahlyrgifpvvckdpvqeawaedvdlrvnlamnvgkargffkkgdvvivltgwr
pgsgftntmrvvpvp

SCOP Domain Coordinates for d1a5ug3:

Click to download the PDB-style file with coordinates for d1a5ug3.
(The format of our PDB-style files is described here.)

Timeline for d1a5ug3: