SCOPe 2.06: Domain d4lgpd_: 4lgp D:

Lineage for d4lgpd_ (4lgp D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (35 PDB entries)

8. Domain d4lgpd_: 4lgp D: [331222]
   automated match to d4y7ma_
   complexed with cl, edo

Details for d4lgpd_

PDB Entry: 4lgp, 2.4 Å

PDB Description: ricin a chain bound to camelid nanobody (vhh1)

PDB Compounds: (D:) VHH1 camelid nanobody

SCOPe Domain Sequences for d4lgpd_:

Sequence; same for both SEQRES and ATOM records:

>d4lgpd_ b.1.1.1 (D:) automated matches {Vicugna pacos [TaxId: 30538]}
vqlvetggglvqpggsltlscagsggtlehyaigwfrqapgkehewlvcnrgeygstvyv
dsvkgrftasrdnakntvylqlnslkpddtgiyycvsgcyswrgpwgqgtqvtvs

Timeline for d4lgpd_:

• d4lgpd_ is new in SCOPe 2.06-stable
  
• d4lgpd_ appears in SCOPe 2.07
  
• d4lgpd_ appears in the current release, SCOPe 2.08