Lineage for d1a5uf3 (1a5u F:3996-4130)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71332Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
  4. 71333Superfamily c.49.1: Pyruvate kinase, C-terminal domain [52935] (1 family) (S)
  5. 71334Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
  6. 71335Protein Pyruvate kinase, C-terminal domain [52937] (5 species)
  7. 71365Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [52939] (4 PDB entries)
  8. 71379Domain d1a5uf3: 1a5u F:3996-4130 [33122]
    Other proteins in same PDB: d1a5ua1, d1a5ua2, d1a5ub1, d1a5ub2, d1a5uc1, d1a5uc2, d1a5ud1, d1a5ud2, d1a5ue1, d1a5ue2, d1a5uf1, d1a5uf2, d1a5ug1, d1a5ug2, d1a5uh1, d1a5uh2

Details for d1a5uf3

PDB Entry: 1a5u (more details), 2.35 Å

PDB Description: pyruvate kinase complex with bis mg-atp-na-oxalate

SCOP Domain Sequences for d1a5uf3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a5uf3 c.49.1.1 (F:3996-4130) Pyruvate kinase, C-terminal domain {Rabbit (Oryctolagus cuniculus)}
elarssshstdlmeamamgsveasykclaaalivltesgrsahqvaryrprapiiavtrn
hqtarqahlyrgifpvvckdpvqeawaedvdlrvnlamnvgkargffkkgdvvivltgwr
pgsgftntmrvvpvp

SCOP Domain Coordinates for d1a5uf3:

Click to download the PDB-style file with coordinates for d1a5uf3.
(The format of our PDB-style files is described here.)

Timeline for d1a5uf3: