SCOPe 2.08: Domain d5moya1: 5moy A:873-1092

Lineage for d5moya1 (5moy A:873-1092)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 proteins)
   automatically mapped to Pfam PF07953

6. Protein automated matches [229097] (6 species)
   not a true protein

7. Species Clostridium botulinum [TaxId:1491] [229098] (12 PDB entries)

8. Domain d5moya1: 5moy A:873-1092 [331219]
   Other proteins in same PDB: d5moya2
   automated match to d3btaa1
   complexed with 2pe, edo

Details for d5moya1

PDB Entry: 5moy, 2.3 Å

PDB Description: crystal structure of the bont/a2 receptor-binding domain in complex with the luminal domain of its neuronal receptor sv2c

PDB Compounds: (A:) Botulinum neurotoxin type A

SCOPe Domain Sequences for d5moya1:

Sequence; same for both SEQRES and ATOM records:

>d5moya1 b.29.1.6 (A:873-1092) automated matches {Clostridium botulinum [TaxId: 1491]}
ivntsilsivykkddlidlsrygakinigdrvyydsidknqiklinlesstievilknai
vynsmyenfstsfwikipkyfskinlnneytiinciennsgwkvslnygeiiwtlqdnkq
niqrvvfkysqmvnisdyinrwifvtitnnrltkskiyingrlidqkpisnlgnihasnk
imfkldgcrdprryimikyfnlfdkelnekeikdlydsqs

Timeline for d5moya1:

• d5moya1 first appeared in SCOPe 2.06
  
• d5moya1 appears in SCOPe 2.07