| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 proteins) automatically mapped to Pfam PF07953 |
| Protein automated matches [229097] (6 species) not a true protein |
| Species Clostridium botulinum [TaxId:1491] [229098] (12 PDB entries) |
| Domain d5moya1: 5moy A:873-1092 [331219] Other proteins in same PDB: d5moya2 automated match to d3btaa1 complexed with 2pe, edo |
PDB Entry: 5moy (more details), 2.3 Å
SCOPe Domain Sequences for d5moya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5moya1 b.29.1.6 (A:873-1092) automated matches {Clostridium botulinum [TaxId: 1491]}
ivntsilsivykkddlidlsrygakinigdrvyydsidknqiklinlesstievilknai
vynsmyenfstsfwikipkyfskinlnneytiinciennsgwkvslnygeiiwtlqdnkq
niqrvvfkysqmvnisdyinrwifvtitnnrltkskiyingrlidqkpisnlgnihasnk
imfkldgcrdprryimikyfnlfdkelnekeikdlydsqs
Timeline for d5moya1: