Class b: All beta proteins [48724] (177 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.14: Histone demethylase core [254153] (4 proteins) Jumonji domain; Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801 |
Protein automated matches [254635] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255633] (263 PDB entries) |
Domain d5pk2a_: 5pk2 A: [331180] automated match to d3dxua_ complexed with edo, mg, ni, oga, so4, zn |
PDB Entry: 5pk2 (more details), 1.42 Å
SCOPe Domain Sequences for d5pk2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5pk2a_ b.82.2.14 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} aqnpncnimifhptkeefndfdkyiaymesqgahraglakiippkewkaretydniseil iatplqqvasgragvftqyhkkkkamtvgeyrhlanskkyqtpphqnfedlerkywknri ynspiygadisgslfdentkqwnlghlgtiqdllekecgvviegvntpylyfgmwkttfa whtedmdlysinylhlgepktwyvvppehgqrlerlarelfpgssrgcgaflrhkvalis ptvlkengipfnritqeagefmvtfpygyhagfnhgfncaeainfatprwidygkmasqc scgearvtfsmdafvrilqperydlwkrgqd
Timeline for d5pk2a_: