Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries) |
Domain d4lhqb_: 4lhq B: [331168] Other proteins in same PDB: d4lhqa_, d4lhqc_ automated match to d4ocmc_ |
PDB Entry: 4lhq (more details), 2.3 Å
SCOPe Domain Sequences for d4lhqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lhqb_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]} vqlvetgggtvqtggslrlscsasggsfsrnamgwfrqapgkerefvaainwsasstyyr dsvkgrftvsrdnakntvylhlnslkledtaayycagssvyaempyadsvkatsynywgq gtqvtvss
Timeline for d4lhqb_: