Lineage for d1a49h3 (1a49 H:5196-5330)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2488765Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 2488766Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) (S)
  5. 2488767Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
    automatically mapped to Pfam PF02887
  6. 2488768Protein Pyruvate kinase, C-terminal domain [52937] (6 species)
  7. 2488821Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [52939] (7 PDB entries)
  8. 2488837Domain d1a49h3: 1a49 H:5196-5330 [33116]
    Other proteins in same PDB: d1a49a1, d1a49a2, d1a49b1, d1a49b2, d1a49c1, d1a49c2, d1a49d1, d1a49d2, d1a49e1, d1a49e2, d1a49f1, d1a49f2, d1a49g1, d1a49g2, d1a49h1, d1a49h2
    complexed with atp, k, mg, oxl

Details for d1a49h3

PDB Entry: 1a49 (more details), 2.1 Å

PDB Description: bis mg-atp-k-oxalate complex of pyruvate kinase
PDB Compounds: (H:) pyruvate kinase

SCOPe Domain Sequences for d1a49h3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a49h3 c.49.1.1 (H:5196-5330) Pyruvate kinase, C-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
elarssshstdlmeamamgsveasykclaaalivltesgrsahqvaryrprapiiavtrn
hqtarqahlyrgifpvvckdpvqeawaedvdlrvnlamnvgkargffkkgdvvivltgwr
pgsgftntmrvvpvp

SCOPe Domain Coordinates for d1a49h3:

Click to download the PDB-style file with coordinates for d1a49h3.
(The format of our PDB-style files is described here.)

Timeline for d1a49h3: