| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.6: PMT1231-like [158402] (2 proteins) PfamB PB016165 automatically mapped to Pfam PF11266 |
| Protein automated matches [261918] (5 species) not a true protein |
| Species Limnothrix sp. [TaxId:1162714] [331043] (1 PDB entry) |
| Domain d5k52b1: 5k52 B:10-228 [331126] Other proteins in same PDB: d5k52a2, d5k52b2, d5k52c2, d5k52d2 automated match to d4z5sa_ complexed with ocd |
PDB Entry: 5k52 (more details), 2.4 Å
SCOPe Domain Sequences for d5k52b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k52b1 a.25.1.6 (B:10-228) automated matches {Limnothrix sp. [TaxId: 1162714]}
idyqsetykdaysrinaiviegedeaannyvrlaelmpeqseelaslakmearhkkgfta
cgknlnvtpdmdfakkffsdlhgnfqvaaaagnivtclliqaliieafaisaynvyipha
ddfarkitenvvkdeylhlnfgeqwlkanfesakdeleranrenlaivwrmldevagdal
vlgmekealmedftiayqealqnigfstretlrmltagl
Timeline for d5k52b1: