SCOPe 2.08: Domain d5lgja3: 5lgj A:439-545

Lineage for d5lgja3 (5lgj A:439-545)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5lgja3: 5lgj A:439-545 [331113]
   automated match to d1o0va3
   complexed with gol, pg4, so4; mutant

Details for d5lgja3

PDB Entry: 5lgj, 2.6 Å

PDB Description: the crystal structure of ige fc mutant - p333c

PDB Compounds: (A:) ig epsilon chain c region

SCOPe Domain Sequences for d5lgja3:

Sequence; same for both SEQRES and ATOM records:

>d5lgja3 b.1.1.0 (A:439-545) automated matches {Human (Homo sapiens) [TaxId: 9606]}
praapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprkt
kgsgffvfsrlevtraeweqkdeficravheaaspsqtvqravsvnp

Timeline for d5lgja3:

• d5lgja3 first appeared in SCOPe 2.06
  
• d5lgja3 appears in SCOPe 2.07