| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (24 species) not a true protein |
| Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries) |
| Domain d4lgpb_: 4lgp B: [331108] Other proteins in same PDB: d4lgpa_, d4lgpc_ automated match to d4y7ma_ complexed with cl, edo |
PDB Entry: 4lgp (more details), 2.4 Å
SCOPe Domain Sequences for d4lgpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lgpb_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlvetggglvqpggsltlscagsggtlehyaigwfrqapgkehewlvcnrgeygstvy
vdsvkgrftasrdnakntvylqlnslkpddtgiyycvsgcyswrgpwgqgtqvtvs
Timeline for d4lgpb_: