Lineage for d1a49b3 (1a49 B:996-1130)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71332Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
  4. 71333Superfamily c.49.1: Pyruvate kinase, C-terminal domain [52935] (1 family) (S)
  5. 71334Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
  6. 71335Protein Pyruvate kinase, C-terminal domain [52937] (5 species)
  7. 71365Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [52939] (4 PDB entries)
  8. 71367Domain d1a49b3: 1a49 B:996-1130 [33110]
    Other proteins in same PDB: d1a49a1, d1a49a2, d1a49b1, d1a49b2, d1a49c1, d1a49c2, d1a49d1, d1a49d2, d1a49e1, d1a49e2, d1a49f1, d1a49f2, d1a49g1, d1a49g2, d1a49h1, d1a49h2

Details for d1a49b3

PDB Entry: 1a49 (more details), 2.1 Å

PDB Description: bis mg-atp-k-oxalate complex of pyruvate kinase

SCOP Domain Sequences for d1a49b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a49b3 c.49.1.1 (B:996-1130) Pyruvate kinase, C-terminal domain {Rabbit (Oryctolagus cuniculus)}
elarssshstdlmeamamgsveasykclaaalivltesgrsahqvaryrprapiiavtrn
hqtarqahlyrgifpvvckdpvqeawaedvdlrvnlamnvgkargffkkgdvvivltgwr
pgsgftntmrvvpvp

SCOP Domain Coordinates for d1a49b3:

Click to download the PDB-style file with coordinates for d1a49b3.
(The format of our PDB-style files is described here.)

Timeline for d1a49b3: