SCOPe 2.08: Domain d5ihzf2: 5ihz F:128-229

Lineage for d5ihzf2 (5ihz F:128-229)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5ihzf2: 5ihz F:128-229 [331091]
   Other proteins in same PDB: d5ihza_, d5ihzb1, d5ihzc_, d5ihzd1, d5ihze_, d5ihzf1, d5ihzh_, d5ihzl1
   automated match to d5azel2

Details for d5ihzf2

PDB Entry: 5ihz, 1.64 Å

PDB Description: crystal structure of anti-gliadin 1002-1e01 fab fragment

PDB Compounds: (F:) 1E01 Fab fragment light chain

SCOPe Domain Sequences for d5ihzf2:

Sequence; same for both SEQRES and ATOM records:

>d5ihzf2 b.1.1.2 (F:128-229) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpsk
qsnnkyaassylsltpeqwkshrsyscqvthegstvektvap

Timeline for d5ihzf2:

• d5ihzf2 first appeared in SCOPe 2.06
  
• d5ihzf2 appears in SCOPe 2.07