Lineage for d5jjmc_ (5jjm C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2728287Protein Androgen receptor [63621] (4 species)
  7. 2728297Species Human (Homo sapiens) [TaxId:9606] [63623] (65 PDB entries)
    Uniprot P10275 671-919
  8. 2728350Domain d5jjmc_: 5jjm C: [331082]
    automated match to d1t65a_
    complexed with act, cl, dht, edo, gol, pge, so4, zn

Details for d5jjmc_

PDB Entry: 5jjm (more details), 2.15 Å

PDB Description: crystal structure of homodimeric androgen receptor ligand-binding domain bound to dht and lxxll peptide
PDB Compounds: (C:) Androgen receptor

SCOPe Domain Sequences for d5jjmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jjmc_ a.123.1.1 (C:) Androgen receptor {Human (Homo sapiens) [TaxId: 9606]}
ecqpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrn
lhvddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrm
rhlsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrk
nptscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkil
sgkvkpiyfh

SCOPe Domain Coordinates for d5jjmc_:

Click to download the PDB-style file with coordinates for d5jjmc_.
(The format of our PDB-style files is described here.)

Timeline for d5jjmc_: