Lineage for d1pkma3 (1pkm A:396-530)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1855807Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 1855808Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) (S)
  5. 1855809Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
    automatically mapped to Pfam PF02887
  6. 1855810Protein Pyruvate kinase, C-terminal domain [52937] (6 species)
  7. 1855816Species Cat (Felis catus) [TaxId:9685] [52938] (1 PDB entry)
  8. 1855817Domain d1pkma3: 1pkm A:396-530 [33108]
    Other proteins in same PDB: d1pkma1, d1pkma2

Details for d1pkma3

PDB Entry: 1pkm (more details), 2.6 Å

PDB Description: the refined three-dimensional structure of cat muscle (m1) pyruvate kinase, at a resolution of 2.6 angstroms
PDB Compounds: (A:) m1 pyruvate kinase

SCOPe Domain Sequences for d1pkma3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkma3 c.49.1.1 (A:396-530) Pyruvate kinase, C-terminal domain {Cat (Felis catus) [TaxId: 9685]}
elvrgsshstdlmeamamgsveasykclaaalivltesgrsahqvaryrprapiiavtrn
hqtarqahlyrgifpvvckdpvqeawaedvdlrvnlamnvgkargffkhgdvvivltgwr
pgsgftntmrvvpvp

SCOPe Domain Coordinates for d1pkma3:

Click to download the PDB-style file with coordinates for d1pkma3.
(The format of our PDB-style files is described here.)

Timeline for d1pkma3: