SCOPe 2.08: Domain d1pkma3: 1pkm A:396-530

Lineage for d1pkma3 (1pkm A:396-530)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest

4. Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families)

5. Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
   automatically mapped to Pfam PF02887

6. Protein Pyruvate kinase, C-terminal domain [52937] (6 species)

7. Species Cat (Felis catus) [TaxId:9685] [52938] (1 PDB entry)

8. Domain d1pkma3: 1pkm A:396-530 [33108]
   Other proteins in same PDB: d1pkma1, d1pkma2

Details for d1pkma3

PDB Entry: 1pkm, 2.6 Å

PDB Description: the refined three-dimensional structure of cat muscle (m1) pyruvate kinase, at a resolution of 2.6 angstroms

PDB Compounds: (A:) m1 pyruvate kinase

SCOPe Domain Sequences for d1pkma3:

Sequence; same for both SEQRES and ATOM records:

>d1pkma3 c.49.1.1 (A:396-530) Pyruvate kinase, C-terminal domain {Cat (Felis catus) [TaxId: 9685]}
elvrgsshstdlmeamamgsveasykclaaalivltesgrsahqvaryrprapiiavtrn
hqtarqahlyrgifpvvckdpvqeawaedvdlrvnlamnvgkargffkhgdvvivltgwr
pgsgftntmrvvpvp

Timeline for d1pkma3:

• d1pkma3 first appeared (with stable ids) in SCOP 1.55, called d1pkm_3
  
• d1pkma3 appears in SCOPe 2.07