![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (28 families) ![]() |
![]() | Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein) automatically mapped to Pfam PF00613 this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain |
![]() | Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48402] (77 PDB entries) |
![]() | Domain d5jhaa2: 5jha A:545-725 [331075] Other proteins in same PDB: d5jhaa1, d5jhaa3, d5jhaa4 automated match to d1e8ya1 complexed with 6k7, so4 |
PDB Entry: 5jha (more details), 2.51 Å
SCOPe Domain Sequences for d5jhaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jhaa2 a.118.1.6 (A:545-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]} aempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqeiv aktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlv qavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgc g
Timeline for d5jhaa2: