Lineage for d2pdaa3 (2pda A:259-415)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24575Fold c.48: Transketolase C-terminal domain-like [52921] (1 superfamily)
  4. 24576Superfamily c.48.1: Transketolase C-terminal domain-like [52922] (3 families) (S)
  5. 24599Family c.48.1.3: Pyruvate-ferredoxin oxidoreductase, PFOR, domain II [52931] (1 protein)
  6. 24600Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain II [52932] (1 species)
  7. 24601Species Desulfovibrio africanus [TaxId:873] [52933] (2 PDB entries)
  8. 24604Domain d2pdaa3: 2pda A:259-415 [33106]
    Other proteins in same PDB: d2pdaa1, d2pdaa2, d2pdaa4, d2pdaa5, d2pdab1, d2pdab2, d2pdab4, d2pdab5

Details for d2pdaa3

PDB Entry: 2pda (more details), 3 Å

PDB Description: crystal structure of the complex between pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus and pyruvate.

SCOP Domain Sequences for d2pdaa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pdaa3 c.48.1.3 (A:259-415) Pyruvate-ferredoxin oxidoreductase, PFOR, domain II {Desulfovibrio africanus}
klfdyvgapdaervivsmgsscetieevinhlaakgekiglikvrlyrpfvseaffaalp
asakvitvldrtkepgapgdplyldvcsafvergeampkilagryglgskefspamvksv
ydnmsgakknhftvgieddvtgtslpvdnafadttpk

SCOP Domain Coordinates for d2pdaa3:

Click to download the PDB-style file with coordinates for d2pdaa3.
(The format of our PDB-style files is described here.)

Timeline for d2pdaa3: