SCOPe 2.06: Domain d5ik3b2: 5ik3 B:127-234

Lineage for d5ik3b2 (5ik3 B:127-234)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

8. Domain d5ik3b2: 5ik3 B:127-234 [331058]
   Other proteins in same PDB: d5ik3b1, d5ik3d1
   automated match to d1dn0a2
   complexed with so4

Details for d5ik3b2

PDB Entry: 5ik3, 1.65 Å

PDB Description: crystal structure of anti-gliadin 1002-1e03 fab fragment

PDB Compounds: (B:) 1E03 Fab fragment light chain

SCOPe Domain Sequences for d5ik3b2:

Sequence, based on SEQRES records:

>d5ik3b2 b.1.1.2 (B:127-234) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Sequence, based on observed residues (ATOM records):

>d5ik3b2 b.1.1.2 (B:127-234) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhvyacevthqglsspvtksfnrgec

Timeline for d5ik3b2:

• d5ik3b2 is new in SCOPe 2.06-stable
  
• d5ik3b2 appears in SCOPe 2.07
  
• d5ik3b2 appears in the current release, SCOPe 2.08