Lineage for d5ik3b1 (5ik3 B:1-126)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. Protein automated matches [190740] (30 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1747 PDB entries)
  8. Domain d5ik3b1: 5ik3 B:1-126 [331057]
    Other proteins in same PDB: d5ik3a_, d5ik3b2, d5ik3c_, d5ik3d2
    automated match to d1dn0a1
    complexed with so4

Details for d5ik3b1

PDB Entry: 5ik3 (more details), 1.6500000000000001 Å

PDB Description: crystal structure of anti-gliadin 1002-1e03 fab fragment
PDB Compounds: (B:) 1E03 Fab fragment light chain

SCOPe Domain Sequences for d5ik3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ik3b1 b.1.1.0 (B:1-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqspdslavslgeratinckssqsvlyssnnknylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyyrtppltfgggtkvei

SCOPe Domain Coordinates for d5ik3b1 are not available.

Timeline for d5ik3b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ik3b2
View in 3D
Domains from other chains:
(mouse over for more information)
d5ik3a_, d5ik3c_, d5ik3d1, d5ik3d2