![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) ![]() |
![]() | Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
![]() | Protein automated matches [190418] (18 species) not a true protein |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [187706] (16 PDB entries) |
![]() | Domain d5ls3a_: 5ls3 A: [331051] automated match to d4bp0a_ complexed with zn; mutant |
PDB Entry: 5ls3 (more details), 1.75 Å
SCOPe Domain Sequences for d5ls3a_:
Sequence, based on SEQRES records: (download)
>d5ls3a_ d.157.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} dhvdlpynltatkidsdvfvvtdrdfcssnvlvakmldgtvvivsspfenlgtqtlmdwv aktmkpkkvvainthfhldgtggneiykkmgaetwssdltkqlrleenkkdrikaaefyk nedlkrrilsshpvpadnvfdlkqgkvfsfsnelvevsfpgpahspdnvvvyfpkkkllf ggcmikpkelgylgdanvkawpdsarrlkkfdakivipghgewggpemvnktikvaekav gemrl
>d5ls3a_ d.157.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} dhvdlpynltatkidsdvfvvtdrdfcssnvlvakmldgtvvivsspfenlgtqtlmdwv aktmkpkkvvainthfhldgtggneiykkmgaetwssdltkqlrleenkkdfyknedlkr rilsshpvpadnvfdlkqgkvfsfsnelvevsfpgpahspdnvvvyfpkkkllfggcmik pkelgylgdanvkawpdsarrlkkfdakivipghgewggpemvnktikvaekavgemrl
Timeline for d5ls3a_: