SCOPe 2.08: Domain d5k52d1: 5k52 D:10-228

Lineage for d5k52d1 (5k52 D:10-228)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.6: PMT1231-like [158402] (2 proteins)
   PfamB PB016165
   automatically mapped to Pfam PF11266

6. Protein automated matches [261918] (5 species)
   not a true protein

7. Species Limnothrix sp. [TaxId:1162714] [331043] (1 PDB entry)

8. Domain d5k52d1: 5k52 D:10-228 [331044]
   Other proteins in same PDB: d5k52a2, d5k52b2, d5k52c2, d5k52d2
   automated match to d4z5sa_
   complexed with ocd

Details for d5k52d1

PDB Entry: 5k52, 2.4 Å

PDB Description: crystal structures of aldehyde deformylating oxygenase from limnothrix sp. knua012

PDB Compounds: (D:) Aldehyde decarbonylase

SCOPe Domain Sequences for d5k52d1:

Sequence; same for both SEQRES and ATOM records:

>d5k52d1 a.25.1.6 (D:10-228) automated matches {Limnothrix sp. [TaxId: 1162714]}
idyqsetykdaysrinaiviegedeaannyvrlaelmpeqseelaslakmearhkkgfta
cgknlnvtpdmdfakkffsdlhgnfqvaaaagnivtclliqaliieafaisaynvyipha
ddfarkitenvvkdeylhlnfgeqwlkanfesakdeleranrenlaivwrmldevagdal
vlgmekealmedftiayqealqnigfstretlrmltagl

Timeline for d5k52d1:

• d5k52d1 first appeared in SCOPe 2.06, called d5k52d_
  
• d5k52d1 was called d5k52d_ in SCOPe 2.07