SCOPe 2.08: Domain d5ipea_: 5ipe A:

Lineage for d5ipea_ (5ipe A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.13: HIT-like [54196] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha

4. Superfamily d.13.1: HIT-like [54197] (6 families)

5. Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins)
   Pfam PF01230
   topologically similar to the N-terminal domain of protein kinases

6. Protein automated matches [191082] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189791] (32 PDB entries)

8. Domain d5ipea_: 5ipe A: [331038]
   automated match to d3tw2a_
   complexed with 6cg, cl, edo

Details for d5ipea_

PDB Entry: 5ipe, 1.45 Å

PDB Description: human histidine triad nucleotide binding protein 1 (hhint1) nucleoside thiophosphoramidate catalytic product complex

PDB Compounds: (A:) Histidine triad nucleotide-binding protein 1

SCOPe Domain Sequences for d5ipea_:

Sequence; same for both SEQRES and ATOM records:

>d5ipea_ d.13.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rpggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaeddde
sllghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg

Timeline for d5ipea_:

• d5ipea_ first appeared in SCOPe 2.06
  
• d5ipea_ appears in SCOPe 2.07