SCOPe 2.06: Domain d5ipfd_: 5ipf D:

Lineage for d5ipfd_ (5ipf D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (32 species)
   not a true protein

7. Species Schistosoma mansoni [TaxId:6183] [331002] (1 PDB entry)

8. Domain d5ipfd_: 5ipf D: [331036]
   automated match to d2vfab_
   complexed with imp

Details for d5ipfd_

PDB Entry: 5ipf, 2.8 Å

PDB Description: crystal structure of hypoxanthine-guanine phosphoribosyltransferase from schistosoma mansoni in complex with imp

PDB Compounds: (D:) Hypoxanthine-guanine phosphoribosyltransferase (HGPRT)

SCOPe Domain Sequences for d5ipfd_:

Sequence, based on SEQRES records:

>d5ipfd_ c.61.1.0 (D:) automated matches {Schistosoma mansoni [TaxId: 6183]}
adcvviedsfrgfpteyfctsprydecldyvlipngmikdrlekmsmnivdyyeacnats
itlmcvlkggfkfladlvdglertvrargivlpmsvefvrvksyvndvsihepiltglgd
pseykdknvlvvediidtgktitklishldslstksvkvasllvkrtsprndyrpdfvgf
evpnrfvvgyaldyndnfrdlhhicvinevgqkkfsv

Sequence, based on observed residues (ATOM records):

>d5ipfd_ c.61.1.0 (D:) automated matches {Schistosoma mansoni [TaxId: 6183]}
adcvviedsfrgfpteyfctsprydecldyvlipngmikdrlekmsmnivdyyeacnats
itlmcvlkggfkfladlvdglertvrargivlpmsvefvrdknvlvvediidtgktitkl
ishldsstksvkvasllvkrtrndyrpdfvgfevpnrfvvgyaldyndnfrdlhhicvin
evgqkkfsv

Timeline for d5ipfd_:

• d5ipfd_ is new in SCOPe 2.06-stable
  
• d5ipfd_ appears in SCOPe 2.07
  
• d5ipfd_ appears in the current release, SCOPe 2.08