Lineage for d1qs0b2 (1qs0 B:206-339)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 316015Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 316016Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) (S)
  5. 316045Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (3 proteins)
  6. 316046Protein 2-oxoisovalerate dehydrogenase E1b, C-domain [52929] (1 species)
  7. 316047Species Pseudomonas putida [TaxId:303] [52930] (1 PDB entry)
  8. 316048Domain d1qs0b2: 1qs0 B:206-339 [33103]
    Other proteins in same PDB: d1qs0a_, d1qs0b1
    complexed with hri, mg, tdp

Details for d1qs0b2

PDB Entry: 1qs0 (more details), 2.4 Å

PDB Description: crystal structure of pseudomonas putida 2-oxoisovalerate dehydrogenase (branched-chain alpha-keto acid dehydrogenase, e1b)

SCOP Domain Sequences for d1qs0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qs0b2 c.48.1.2 (B:206-339) 2-oxoisovalerate dehydrogenase E1b, C-domain {Pseudomonas putida}
yytvpldkaaitrpgndvsvltygttvyvaqvaaeesgvdaevidlrslwpldldtives
vkktgrcvvvheatrtcgfgaelvslvqehcfhhleapiervtgwdtpyphaqewayfpg
psrvgaalkkvmev

SCOP Domain Coordinates for d1qs0b2:

Click to download the PDB-style file with coordinates for d1qs0b2.
(The format of our PDB-style files is described here.)

Timeline for d1qs0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qs0b1
View in 3D
Domains from other chains:
(mouse over for more information)
d1qs0a_