![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.48: Transketolase C-terminal domain-like [52921] (1 superfamily) |
![]() | Superfamily c.48.1: Transketolase C-terminal domain-like [52922] (3 families) ![]() |
![]() | Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-domain [52926] (2 proteins) |
![]() | Protein Branched-chain alpha-keto acid dehydrogenase [52927] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52928] (1 PDB entry) |
![]() | Domain d1dtwb2: 1dtw B:205-342 [33102] Other proteins in same PDB: d1dtwa1, d1dtwb1 |
PDB Entry: 1dtw (more details), 2.7 Å
SCOP Domain Sequences for d1dtwb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dtwb2 c.48.1.2 (B:205-342) Branched-chain alpha-keto acid dehydrogenase {Human (Homo sapiens)} pyniplsqaeviqegsdvtlvawgtqvhvirevasmakeklgvscevidlrtiipwdvdt icksviktgrllisheapltggfaseisstvqeecflnleapisrvcgydtpfphifepf yipdkwkcydalrkminy
Timeline for d1dtwb2: