SCOPe 2.08: Domain d1dtwb2: 1dtw B:205-342

Lineage for d1dtwb2 (1dtw B:205-342)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest

4. Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families)

5. Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (5 proteins)
   automatically mapped to Pfam PF02780

6. Protein Branched-chain alpha-keto acid dehydrogenase [52927] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52928] (23 PDB entries)
   Uniprot P21953 52-392

8. Domain d1dtwb2: 1dtw B:205-342 [33102]
   Other proteins in same PDB: d1dtwa_, d1dtwb1
   complexed with k, mg, tdp

Details for d1dtwb2

PDB Entry: 1dtw, 2.7 Å

PDB Description: human branched-chain alpha-keto acid dehydrogenase

PDB Compounds: (B:) branched-chain alpha-keto acid dehydrogenase beta subunit

SCOPe Domain Sequences for d1dtwb2:

Sequence; same for both SEQRES and ATOM records:

>d1dtwb2 c.48.1.2 (B:205-342) Branched-chain alpha-keto acid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
pyniplsqaeviqegsdvtlvawgtqvhvirevasmakeklgvscevidlrtiipwdvdt
icksviktgrllisheapltggfaseisstvqeecflnleapisrvcgydtpfphifepf
yipdkwkcydalrkminy

Timeline for d1dtwb2:

• d1dtwb2 first appeared (with stable ids) in SCOP 1.55
  
• d1dtwb2 appears in SCOPe 2.07