SCOP 1.57: Domain d1ay0b3: 1ay0 B:535-680

Lineage for d1ay0b3 (1ay0 B:535-680)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.48: Transketolase C-terminal domain-like [52921] (1 superfamily)

4. Superfamily c.48.1: Transketolase C-terminal domain-like [52922] (3 families)

5. Family c.48.1.1: Transketolase [52923] (1 protein)

6. Protein Transketolase [52924] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52925] (6 PDB entries)

8. Domain d1ay0b3: 1ay0 B:535-680 [33101]
   Other proteins in same PDB: d1ay0a1, d1ay0a2, d1ay0b1, d1ay0b2

Details for d1ay0b3

PDB Entry: 1ay0, 2.6 Å

PDB Description: identification of catalytically important residues in yeast transketolase

SCOP Domain Sequences for d1ay0b3:

Sequence; same for both SEQRES and ATOM records:

>d1ay0b3 c.48.1.1 (B:535-680) Transketolase {Baker's yeast (Saccharomyces cerevisiae)}
egssiesaskggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftf
dkqpleyrlsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpe
gvaeraqktiafykgdklisplkkaf

Timeline for d1ay0b3:

• d1ay0b3 first appeared (with stable ids) in SCOP 1.55
  
• d1ay0b3 appears in SCOP 1.59
  
• d1ay0b3 appears in the current release, SCOPe 2.08