Lineage for d5hzuj_ (5hzu J:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2940626Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2940627Protein automated matches [190526] (26 species)
    not a true protein
  7. 2940765Species Echinophyllia sp. [TaxId:301887] [188534] (31 PDB entries)
  8. 2940837Domain d5hzuj_: 5hzu J: [331009]
    automated match to d2gx2a_
    complexed with ni

Details for d5hzuj_

PDB Entry: 5hzu (more details), 1.89 Å

PDB Description: crystal structure of dronpa-ni2+
PDB Compounds: (J:) Fluorescent protein Dronpa

SCOPe Domain Sequences for d5hzuj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hzuj_ d.22.1.0 (J:) automated matches {Echinophyllia sp. [TaxId: 301887]}
svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
sygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
vvqlpdyhfvdhhieikshdkdysnvnlhehaeahs

SCOPe Domain Coordinates for d5hzuj_:

Click to download the PDB-style file with coordinates for d5hzuj_.
(The format of our PDB-style files is described here.)

Timeline for d5hzuj_: