Lineage for d5ikua1 (5iku A:773-890)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774937Family b.18.1.36: Collagen-binding domain [267607] (1 protein)
    PubMed 17977833 describes likely homology between (d2quoa_), (d1w99a3), and (d1nqdb_)
  6. 2774938Protein Class 1 collagenase [267633] (1 species)
  7. 2774939Species Clostridium histolyticum [TaxId:1498] [267693] (5 PDB entries)
  8. 2774948Domain d5ikua1: 5iku A:773-890 [331006]
    Other proteins in same PDB: d5ikua3
    automated match to d1nqda_
    complexed with ca

Details for d5ikua1

PDB Entry: 5iku (more details), 1.9 Å

PDB Description: crystal structure of the hathewaya histolytica colg tandem collagen- binding domain s3as3b in the presence of calcium at 1.9 angstrom resolution
PDB Compounds: (A:) collagenase

SCOPe Domain Sequences for d5ikua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ikua1 b.18.1.36 (A:773-890) Class 1 collagenase {Clostridium histolyticum [TaxId: 1498]}
tttpitkemepnddikeangpivegvtvkgdlngsddadtfyfdvkedgdvtielpysgs
snftwlvykegddqnhiasgidknnskvgtfkstkgrhyvfiykhdsasnisyslnik

SCOPe Domain Coordinates for d5ikua1:

Click to download the PDB-style file with coordinates for d5ikua1.
(The format of our PDB-style files is described here.)

Timeline for d5ikua1: