SCOPe 2.08: Domain d5ipfa_: 5ipf A:

Lineage for d5ipfa_ (5ipf A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (38 species)
   not a true protein

7. Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [331002] (1 PDB entry)

8. Domain d5ipfa_: 5ipf A: [331005]
   automated match to d2vfab_
   complexed with imp

Details for d5ipfa_

PDB Entry: 5ipf, 2.8 Å

PDB Description: crystal structure of hypoxanthine-guanine phosphoribosyltransferase from schistosoma mansoni in complex with imp

PDB Compounds: (A:) Hypoxanthine-guanine phosphoribosyltransferase (HGPRT)

SCOPe Domain Sequences for d5ipfa_:

Sequence, based on SEQRES records:

>d5ipfa_ c.61.1.0 (A:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
adcvviedsfrgfpteyfctsprydecldyvlipngmikdrlekmsmnivdyyeacnats
itlmcvlkggfkfladlvdglertvrargivlpmsvefvrvksyvndvsihepiltglgd
pseykdknvlvvediidtgktitklishldslstksvkvasllvkrtsprndyrpdfvgf
evpnrfvvgyaldyndnfrdlhhicvinevgqkkfsv

Sequence, based on observed residues (ATOM records):

>d5ipfa_ c.61.1.0 (A:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
adcvviedsfrgfpteyfctsprydecldyvlipngmikdrlekmsmnivdyyeacnats
itlmcvlkggfkfladlvdglertvrargivlpmsvefvrglgdpseykdknvlvvedii
dtgktitklishldslstksvkvasllvkrtsprndyrpdfvgfevpnrfvvgyaldynd
nfrdlhhicvinevgqkkfsv

Timeline for d5ipfa_:

• d5ipfa_ first appeared in SCOPe 2.06
  
• d5ipfa_ appears in SCOPe 2.07