Lineage for d1ay0a3 (1ay0 A:535-680)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 123735Fold c.48: Transketolase C-terminal domain-like [52921] (1 superfamily)
  4. 123736Superfamily c.48.1: Transketolase C-terminal domain-like [52922] (3 families) (S)
  5. 123737Family c.48.1.1: Transketolase [52923] (1 protein)
  6. 123738Protein Transketolase [52924] (1 species)
  7. 123739Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52925] (7 PDB entries)
  8. 123752Domain d1ay0a3: 1ay0 A:535-680 [33100]
    Other proteins in same PDB: d1ay0a1, d1ay0a2, d1ay0b1, d1ay0b2

Details for d1ay0a3

PDB Entry: 1ay0 (more details), 2.6 Å

PDB Description: identification of catalytically important residues in yeast transketolase

SCOP Domain Sequences for d1ay0a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ay0a3 c.48.1.1 (A:535-680) Transketolase {Baker's yeast (Saccharomyces cerevisiae)}
egssiesaskggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftf
dkqpleyrlsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpe
gvaeraqktiafykgdklisplkkaf

SCOP Domain Coordinates for d1ay0a3:

Click to download the PDB-style file with coordinates for d1ay0a3.
(The format of our PDB-style files is described here.)

Timeline for d1ay0a3: