Lineage for d1ay0a3 (1ay0 A:535-680)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins)
  6. Protein Transketolase (TK), C-domain [52924] (4 species)
    two N-terminal domains are PP and Pyr modules of thiamin-binding fold
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52925] (7 PDB entries)
  8. Domain d1ay0a3: 1ay0 A:535-680 [33100]
    Other proteins in same PDB: d1ay0a1, d1ay0a2, d1ay0b1, d1ay0b2
    complexed with ca, tpp

Details for d1ay0a3

PDB Entry: 1ay0 (more details), 2.6 Å

PDB Description: identification of catalytically important residues in yeast transketolase
PDB Compounds: (A:) transketolase

SCOPe Domain Sequences for d1ay0a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ay0a3 c.48.1.1 (A:535-680) Transketolase (TK), C-domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
egssiesaskggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftf
dkqpleyrlsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpe
gvaeraqktiafykgdklisplkkaf

SCOPe Domain Coordinates for d1ay0a3 are not available.

Timeline for d1ay0a3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ay0a1, d1ay0a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1ay0b1, d1ay0b2, d1ay0b3