SCOPe 2.07: Domain d5ik3d1: 5ik3 D:1-126

Lineage for d5ik3d1 (5ik3 D:1-126)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d5ik3d1: 5ik3 D:1-126 [330999]
   Other proteins in same PDB: d5ik3b2, d5ik3d2
   automated match to d1dn0a1
   complexed with so4

Details for d5ik3d1

PDB Entry: 5ik3, 1.65 Å

PDB Description: crystal structure of anti-gliadin 1002-1e03 fab fragment

PDB Compounds: (D:) 1E03 Fab fragment light chain

SCOPe Domain Sequences for d5ik3d1:

Sequence; same for both SEQRES and ATOM records:

>d5ik3d1 b.1.1.0 (D:1-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqspdslavslgeratinckssqsvlyssnnknylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyyrtppltfgggtkvei

Timeline for d5ik3d1:

• d5ik3d1 first appeared in SCOPe 2.06
  
• d5ik3d1 appears in the current release, SCOPe 2.08