| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
| Protein automated matches [190039] (161 species) not a true protein |
| Species Vibrio vulnificus [TaxId:672] [330964] (5 PDB entries) |
| Domain d5b70a1: 5b70 A:96-301 [330997] Other proteins in same PDB: d5b70a2, d5b70b2, d5b70c2, d5b70d2 automated match to d1i6aa_ complexed with gol |
PDB Entry: 5b70 (more details), 2.3 Å
SCOPe Domain Sequences for d5b70a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b70a1 c.94.1.0 (A:96-301) automated matches {Vibrio vulnificus [TaxId: 672]}
mqgqlklgciptiapfllcdlvqeinqrfpqlnlllredtttnlltalrhgeldvlilal
pveidgmesrvvgqdpfkmvisrhqagaikvpikyddlpdesvfllekghcltehavsac
kltdkekinpfsatslhtlvqmvanglgttfipqmaidhglldnqnlvvieppgqqayrd
iglvwrpsssrsktfnqlaevvsell
Timeline for d5b70a1: