Lineage for d5b70a1 (5b70 A:96-301)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916423Species Vibrio vulnificus [TaxId:672] [330964] (5 PDB entries)
  8. 2916432Domain d5b70a1: 5b70 A:96-301 [330997]
    Other proteins in same PDB: d5b70a2, d5b70b2, d5b70c2, d5b70d2
    automated match to d1i6aa_
    complexed with gol

Details for d5b70a1

PDB Entry: 5b70 (more details), 2.3 Å

PDB Description: oxyr2 e204g regulatory domain from vibrio vulnificus
PDB Compounds: (A:) LysR family transcriptional regulator

SCOPe Domain Sequences for d5b70a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b70a1 c.94.1.0 (A:96-301) automated matches {Vibrio vulnificus [TaxId: 672]}
mqgqlklgciptiapfllcdlvqeinqrfpqlnlllredtttnlltalrhgeldvlilal
pveidgmesrvvgqdpfkmvisrhqagaikvpikyddlpdesvfllekghcltehavsac
kltdkekinpfsatslhtlvqmvanglgttfipqmaidhglldnqnlvvieppgqqayrd
iglvwrpsssrsktfnqlaevvsell

SCOPe Domain Coordinates for d5b70a1:

Click to download the PDB-style file with coordinates for d5b70a1.
(The format of our PDB-style files is described here.)

Timeline for d5b70a1: