SCOP 1.61: Domain d1ngsb3: 1ngs B:535-680

Lineage for d1ngsb3 (1ngs B:535-680)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.48: Transketolase C-terminal domain-like [52921] (1 superfamily)

4. Superfamily c.48.1: Transketolase C-terminal domain-like [52922] (3 families)

5. Family c.48.1.1: TK-like [52923] (2 proteins)

6. Protein Transketolase, TK [52924] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52925] (7 PDB entries)

8. Domain d1ngsb3: 1ngs B:535-680 [33099]
   Other proteins in same PDB: d1ngsa1, d1ngsa2, d1ngsb1, d1ngsb2

Details for d1ngsb3

PDB Entry: 1ngs, 2.4 Å

PDB Description: complex of transketolase with thiamin diphosphate, ca2+ and acceptor substrate erythrose-4-phosphate

SCOP Domain Sequences for d1ngsb3:

Sequence; same for both SEQRES and ATOM records:

>d1ngsb3 c.48.1.1 (B:535-680) Transketolase, TK {Baker's yeast (Saccharomyces cerevisiae)}
egssiesaskggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftf
dkqpleyrlsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpe
gvaeraqktiafykgdklisplkkaf

Timeline for d1ngsb3:

• d1ngsb3 first appeared (with stable ids) in SCOP 1.55
  
• d1ngsb3 appears in SCOP 1.59
  
• d1ngsb3 appears in SCOP 1.63
  
• d1ngsb3 appears in the current release, SCOPe 2.08